DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and scaf

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:278 Identity:65/278 - (23%)
Similarity:103/278 - (37%) Gaps:61/278 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VAAATAIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWV 75
            |..|....|..::..||.|||:          .|...::|:...:|...:....|||:|||:.:|
  Fly   406 VNLAGVCATRNKRTKPTGVKDL----------DANFAEIPWQAMILRESSKTLICGGAIIGDQFV 460

  Fly    76 LTAAHCTNGASGVTINYGA-----SLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDISLIRTPHVD 135
            |::|.|.||.....|...|     ...|:|......|......|..|:.....:|:::||     
  Fly   461 LSSASCVNGLPVTDIRVKAGEWELGSTNEPLPFQLTGVKTVDVHPDYDPSTNSHDLAIIR----- 520

  Fly   136 FWHLVNKVELPSY-----------NDRYQDYAGWWAVASGWG----GTYDGSPLPDWLQAVDVQI 185
               |..::|..|:           .|..|.:      .||||    ..::...|   :...|...
  Fly   521 ---LERRLEFASHIQPICISDEDPKDSEQCF------TSGWGKQALSIHEEGAL---MHVTDTLP 573

  Fly   186 MSQSDCSRTWSLHDNMICINTNGGKSTCGGDSGGPLVTHEGN--RLVGVTSFVSSAGCQSGAPAV 248
            .::|:|    |...:.:|..|.  ..:|..|.|..|....|:  ||.|:  |.....|..|....
  Fly   574 QARSEC----SADSSSVCSATK--FDSCQFDVGSALACGSGSSVRLKGI--FAGENSCGEGQTVR 630

  Fly   249 FSRVTGYLDWIRDNTGIS 266
            |::..  :.||  ||..:
  Fly   631 FAKPD--IKWI--NTAFA 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 53/243 (22%)
Tryp_SPc 38..262 CDD:238113 55/245 (22%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 48/210 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435393
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.