DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and prss60.3

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:247 Identity:87/247 - (35%)
Similarity:121/247 - (48%) Gaps:25/247 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQ 101
            ||..|..|..|..|:.|.|.....|..:||||:|.:.||||||||.:|.|..|:......|.|..
Zfish    35 RIVGGVNASPGSWPWQVSLHSPKYGGHFCGGSLISSEWVLTAAHCLSGVSETTLVVYLGRRTQQG 99

  Fly   102 YTHWVGSGNFVQ---HHHYNSGNLHNDISLIR-TPHVDFWHLVNKVELPSYNDRYQDYAGWWAVA 162
            ...:..|.|..:   |..|||....|||:|:| :..|.|.:.:..|.|.:.|..|.  ||..:..
Zfish   100 INIYETSRNVAKSFVHSSYNSNTNDNDIALLRLSSAVTFTNYIRPVCLAAQNSVYS--AGTSSWI 162

  Fly   163 SGWGGTYDG--SPLPDWLQAVDVQIMSQSDCSR---TWSLHDNMICIN-TNGGKSTCGGDSGGPL 221
            :|||....|  .|.|..||...:.:::...|:.   :.::.:||||.. |.|||.||.||||||:
Zfish   163 TGWGDIQAGVNLPAPGILQETMIPVVANDRCNALLGSGTVTNNMICAGLTQGGKDTCQGDSGGPM 227

  Fly   222 VTHEGNRL------VGVTSFVSSAGC-QSGAPAVFSRVTGYLDWIRDNTGIS 266
            ||    ||      .|:||:  ..|| ...:|.|::||:.|..||.....::
Zfish   228 VT----RLCTVWVQAGITSW--GYGCADPNSPGVYTRVSQYQSWISSKISLN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 85/238 (36%)
Tryp_SPc 38..262 CDD:238113 86/240 (36%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 86/240 (36%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.