DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and Hayan

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:286 Identity:70/286 - (24%)
Similarity:123/286 - (43%) Gaps:53/286 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PTPEQKLVPTPVKD---------VKIQGR-----ITNGYPAYEGKVPYIVGLLFS--GNGNWWCG 66
            |.|....|..|.|:         ::..|:     |.:|.....|..|::..:.::  |:..:.||
  Fly   351 PNPNPSRVNLPEKERPSVAACEKIRSGGKPLTVHILDGERVDRGVYPHMAAIAYNSFGSAAFRCG 415

  Fly    67 GSIIGNTWVLTAAHCTNGASGVT--INYGA-SLRN-QPQYTHWVGSGNFVQ---HHHYNSGNLHN 124
            ||:|.:.:|||||||.|......  :..|| ::.| :|.|.    ..|.:.   |..|:..:.:.
  Fly   416 GSLIASRFVLTAAHCVNSDDSTPSFVRLGALNIENPEPGYQ----DINVIDVQIHPDYSGSSKYY 476

  Fly   125 DISLIRTPHVDFWHLVNKVELPS--YNDRYQDYAGWWAVASGWG-GTYDGSPLPDWLQAVDVQIM 186
            ||::::... |...  :.|..|:  |.||....|.:....:||| .......:...|....:.::
  Fly   477 DIAILQLAE-DAKE--SDVIRPACLYTDRSDPPANYKYFVAGWGVMNVTNRAVSKILLRAALDLV 538

  Fly   187 SQSDCSRTWS-------------LHDNMICINTNGGKSTCGGDSGGPLVTH----EGN-RLVGVT 233
            ...:|:.:::             :...:...:.|..|..|.|||||||:..    :|. .:|||.
  Fly   539 PADECNASFAEQPSANRTLRRGVIASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVI 603

  Fly   234 SFVSSAGCQSGAPAVFSRVTGYLDWI 259
            |  |..||.:..|.:::||:.:||:|
  Fly   604 S--SGFGCATKTPGLYTRVSSFLDYI 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 63/256 (25%)
Tryp_SPc 38..262 CDD:238113 64/252 (25%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 63/251 (25%)
Tryp_SPc 385..630 CDD:238113 64/252 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437002
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.