DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and CG8952

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:282 Identity:96/282 - (34%)
Similarity:139/282 - (49%) Gaps:34/282 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLVFLALAVAAATAIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGG 67
            :||.||       ||....|...|.....:||..||.:|..|..|:.|:.|.|......:..|||
  Fly    10 MLVLLA-------AISVVGQPFDPANSSPIKIDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGG 67

  Fly    68 SIIGNTWVLTAAHCTNGASGVTINYG------ASLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDI 126
            |||.:||||||||||||.|.:.:.:|      |:..|       :.|.|.:.|..||. .|:||:
  Fly    68 SIISDTWVLTAAHCTNGLSSIFLMFGTVDLFNANALN-------MTSNNIIIHPDYND-KLNNDV 124

  Fly   127 SLIRTPH-VDFWHLVNKVEL-PSYNDRYQDYAGWWAVASGWGGTYDG-SPLPDWLQAVDVQIMSQ 188
            |||:.|. :.|...:..::| ..|.|.. ||.|..|..:|:|.|.|. ....:.|....|:|:..
  Fly   125 SLIQLPEPLTFSANIQAIQLVGQYGDSI-DYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDN 188

  Fly   189 SDCSRTWSLH---DNMICINTNGGK--STCGGDSGGPLVTHEGN----RLVGVTSFVSSAGCQSG 244
            :||...:..:   |:.:|.....|.  |||.|||||||:.:...    :.:|:.|||:...|...
  Fly   189 ADCVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCTYR 253

  Fly   245 APAVFSRVTGYLDWIRDNTGIS 266
            .|:.::||:.:|.:|.|.|||:
  Fly   254 LPSGYARVSSFLGFIADKTGIA 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 81/239 (34%)
Tryp_SPc 38..262 CDD:238113 81/241 (34%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 81/239 (34%)
Tryp_SPc 38..271 CDD:238113 81/241 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471033
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm50958
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.