DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and CG31269

DIOPT Version :10

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:72 Identity:13/72 - (18%)
Similarity:24/72 - (33%) Gaps:17/72 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 WGRSSVSATTTTDNPCSTHNRNIWCATLGYFDHTNTLTNDSTLGLYAHLSGRIASHGYPLSQERF 108
            |...:.:...|..|.| .||    ||.:    :..:..||...        :.....:|..::.|
  Fly    43 WLSYATAKNKTCYNLC-VHN----CAAV----YDGSCINDRRF--------KCCLATFPAKKQEF 90

  Fly   109 ALATVHR 115
            .:...:|
  Fly    91 KMTGCNR 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 38..262 CDD:238113 13/72 (18%)
CG31269NP_001097818.1 Tryp_SPc 38..258 CDD:238113 13/72 (18%)

Return to query results.
Submit another query.