DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and CG31205

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:239 Identity:59/239 - (24%)
Similarity:94/239 - (39%) Gaps:50/239 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 IVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQYTHWVGSGNFVQ--- 113
            |||:...|:....|.|.:|.:..|:|||||.:.....:| ||....:...     .:.|.|.   
  Fly    55 IVGVTKDGSNTLLCTGILIDSRRVVTAAHCVSKDESESI-YGVVFGDSDS-----SNINLVSAVT 113

  Fly   114 -HHHYNSGNLHNDISLIR-TPHVDFWHLVNKVELPSYNDRY--QDYAGWWAVASGWGGTYDGSPL 174
             |..|:.....||:::|. |..|.|..||..:.|||.::..  .:.:....:.:|..|       
  Fly   114 VHPDYSPRKFENDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAGLEG------- 171

  Fly   175 PDW------LQAVDVQI------MSQSDC-SRTWSLHDNMICINTNGGKSTCGGD-----SGGPL 221
            |.:      .|.:|.:|      :...:| .:.....:.:||.:|.  :|...|.     ||.|.
  Fly   172 PSFDRRHSATQRLDKRIKMTYTKIDSKECHEKQARFPEELICGHTE--RSPLSGSALTEASGTPR 234

  Fly   222 VTHEGNRLVG--VTSFVSSAGCQSGAPAVFSRVTGYLDWIRDNT 263
            ..|    |:|  |..|.||.....|    :..:..:||||..|:
  Fly   235 QFH----LLGIAVAGFFSSDLDHQG----YLNIRPHLDWISKNS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 56/233 (24%)
Tryp_SPc 38..262 CDD:238113 58/236 (25%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 31/118 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.