DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and spirit

DIOPT Version :10

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_572492.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:59 Identity:16/59 - (27%)
Similarity:22/59 - (37%) Gaps:26/59 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 RGTAEA--SRLRVSVLKRLTRLLRPLVPGSPLGSADDRYGVAVLSCGWLAASDPPLIRS 171
            ||..||  :|:|..||.|:                  ||.      |.:..|.||::.|
  Fly   480 RGLTEAVTARIRRQVLPRI------------------RYD------GLIEYSTPPMMDS 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 38..262 CDD:238113 16/59 (27%)
spiritNP_572492.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.