DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and Cela3b

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001100162.1 Gene:Cela3b / 298567 RGDID:1307819 Length:269 Species:Rattus norvegicus


Alignment Length:279 Identity:87/279 - (31%)
Similarity:132/279 - (47%) Gaps:34/279 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLVFLALAVAAATAIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNW-- 63
            ::||..| |.||.|:....|...  |:        .|:.||..|.....|:.|.|.:..:|::  
  Rat     2 LRLLCSL-LLVALASGCGQPSYN--PS--------SRVVNGEDAVPYSWPWQVSLQYEKDGSFHH 55

  Fly    64 WCGGSIIGNTWVLTAAHCTNGASGVTINYG---ASLRNQPQYTHWVGSGNFVQHHHYNSG--NLH 123
            .|||::|...||:||.||.:.:....:..|   ..:...|:....|.:|:...|..:||.  :..
  Rat    56 TCGGTLIAPDWVMTAGHCISTSRTYQVVLGEFERGVEEGPEQVIPVNAGDLFVHPKWNSNCVSCG 120

  Fly   124 NDISLIR-TPHVDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMS 187
            |||:|:: :........|....||...:...:.|..:  .||||......||||.||...:.::.
  Rat   121 NDIALVKLSRSAQLGDTVQLACLPPAGEILPNGAPCY--ISGWGRLSTNGPLPDKLQQALLPVVD 183

  Fly   188 QSDCSR-TW---SLHDNMICINTNGG--KSTCGGDSGGPLVTHEGN---RLVGVTSFVSSAGCQS 243
            .:.||: .|   |:...|:|.   ||  :|.|.|||||||.....|   ::.||||||||.||.:
  Rat   184 YAHCSKWDWWGFSVKKTMVCA---GGDIQSGCNGDSGGPLNCPAENGTWQVHGVTSFVSSLGCNT 245

  Fly   244 -GAPAVFSRVTGYLDWIRD 261
             ..|.||:||:.:.:||.:
  Rat   246 LKKPTVFTRVSAFNEWIEE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 76/239 (32%)
Tryp_SPc 38..262 CDD:238113 77/242 (32%)
Cela3bNP_001100162.1 Tryp_SPc 27..262 CDD:214473 76/239 (32%)
Tryp_SPc 28..265 CDD:238113 77/242 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.