DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and Tpsb2

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:287 Identity:94/287 - (32%)
Similarity:130/287 - (45%) Gaps:50/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLVFLALAVAAAT--AIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNW 63
            :|||:.|||:..|:.  |.|.|           ||.:..|..|..|.|.|.|:.|.|.|  ..::
  Rat     2 LKLLLLLALSPLASLVHAAPCP-----------VKQRVGIVGGREASESKWPWQVSLRF--KFSF 53

  Fly    64 W---CGGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQ--PQYTHWVGS----GNFVQHHHYNS 119
            |   ||||:|...||||||||.    |:.|......|.|  .||.::...    ...|.|.||.:
  Rat    54 WMHFCGGSLIHPQWVLTAAHCV----GLHIKSPELFRVQLREQYLYYADQLLTVNRTVVHPHYYT 114

  Fly   120 GNLHNDISLIRTPH-VDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPL--PDWLQAV 181
            .....||:|:...: |:....::...||..::.:......|  .:|||......||  |..|:.|
  Rat   115 VEDGADIALLELENPVNVSTHIHPTSLPPASETFPSGTSCW--VTGWGDIDSDEPLLPPYPLKQV 177

  Fly   182 DVQIMSQSDCSRTWS-----------LHDNMICINTNGGKSTCGGDSGGPLVTH-EGNRL-VGVT 233
            .|.|:..|.|.|.:.           :.|.|:|.. |....:|.||||||||.. :|..| .||.
  Rat   178 KVPIVENSLCDRKYHTGLYTGDDVPIVQDGMLCAG-NTRSDSCQGDSGGPLVCKVKGTWLQAGVV 241

  Fly   234 SFVSSAGC-QSGAPAVFSRVTGYLDWI 259
            |:  ..|| ::..|.:::|||.|||||
  Rat   242 SW--GEGCAEANRPGIYTRVTYYLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 80/247 (32%)
Tryp_SPc 38..262 CDD:238113 82/248 (33%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 82/248 (33%)
Tryp_SPc 30..266 CDD:214473 80/246 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.