DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and Mcpt2

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_742041.1 Gene:Mcpt2 / 29266 RGDID:621058 Length:247 Species:Rattus norvegicus


Alignment Length:204 Identity:68/204 - (33%)
Similarity:98/204 - (48%) Gaps:23/204 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CGGSIIGNTWVLTAAHCTNGASGVTINYGA-SLRNQPQYTHWVGSGNFVQHHHYNS-GNLHNDIS 127
            |||.:|...:|||||||.  ...:|:..|| .:|.:......:.....:.|..||| .||| ||.
  Rat    50 CGGFLISRQFVLTAAHCK--GREITVILGAHDVRKRESTQQKIKVEKQIIHESYNSVPNLH-DIM 111

  Fly   128 LIR-TPHVDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDC 191
            |:: ...|:....||.|.|||.:|.....|..|  |:|||.|....|....|:.|:::||.:..|
  Rat   112 LLKLEKKVELTPAVNVVPLPSPSDFIHPGAMCW--AAGWGKTGVRDPTSYTLREVELRIMDEKAC 174

  Fly   192 -SRTWSLHDNMICINTNGGKSTCG----GDSGGPLVTHEGNRLVGVTSFVSSAG-CQSGAPAVFS 250
             ...:..:...:|:   |..:|..    |||||||:      ..||...:.|.| ..:..||:|:
  Rat   175 VDYRYYEYKFQVCV---GSPTTLRAAFMGDSGGPLL------CAGVAHGIVSYGHPDAKPPAIFT 230

  Fly   251 RVTGYLDWI 259
            ||:.|:.||
  Rat   231 RVSTYVPWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 66/202 (33%)
Tryp_SPc 38..262 CDD:238113 68/204 (33%)
Mcpt2NP_742041.1 Tryp_SPc 20..239 CDD:214473 66/202 (33%)
Tryp_SPc 21..242 CDD:238113 68/204 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.