DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and CG18636

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:270 Identity:72/270 - (26%)
Similarity:114/270 - (42%) Gaps:60/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PVKDVKIQG----RITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGV 88
            |...::.|.    ||.||:.|.....|::| .|.|....:.||||:|.:..|||||||......:
  Fly    31 PACGIRTQSRTAYRIINGHTAKYNSSPWMV-FLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHL 94

  Fly    89 TINYGASLRNQPQ----------YTHWVGSGNFVQHHHYNSGNLHNDISLIR-----------TP 132
            ....|...|.:.:          ..|.|.:|  .:|..|:.....|||:::|           .|
  Fly    95 VARLGEYERTRSEECTGYYCNFREEHMVDAG--FKHKLYDPNTHANDIAILRLSKSVVYRDNIRP 157

  Fly   133 HVDFW-----HLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCS 192
            ....|     |.::|::|              ..|:|||.|...|. .|.||.:|::......|:
  Fly   158 ICVVWDHRWRHYLDKIDL--------------LTATGWGKTQMESD-SDALQTLDIRRQPPDVCA 207

  Fly   193 R--TWSLHDNMICINTNGGKSTCGGDSGGPL---VTHEGNR---LVGVTSFVSSAGCQSGAPAVF 249
            :  ..::..|..|.. |...:.|.|||||||   :||:..:   .||:.|: ::..||..  :||
  Fly   208 KFIGQTIAGNQFCAG-NWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASY-TNRNCQKA--SVF 268

  Fly   250 SRVTGYLDWI 259
            :.|..:.::|
  Fly   269 TDVLSHAEFI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 69/255 (27%)
Tryp_SPc 38..262 CDD:238113 69/256 (27%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 69/255 (27%)
Tryp_SPc 45..278 CDD:238113 68/254 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435967
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.