DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and Sp212

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:334 Identity:79/334 - (23%)
Similarity:130/334 - (38%) Gaps:109/334 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ALAVAAATAIPT---------PEQKLVPTPVKDVKI------------QGRITNGYPAYEGK-VP 50
            ::.:..|..:||         |....:|||...|.:            :.:|::.....||. .|
  Fly   211 SVPITFAPPVPTITSSPAPAPPPPPPLPTPPAVVTVPPATPPPQRFDPRSQISSVVCGREGSTTP 275

  Fly    51 YIVGLLFSGN----GNW-W---------------CGGSIIGNTWVLTAAHCTNGASGVTI----- 90
            :||    .||    |.: |               |.||:|.::.|::||||.:..:...:     
  Fly   276 FIV----RGNEFPRGQYPWLSAVYHKEVRALAFKCRGSLISSSIVISAAHCVHRMTEDRVVVGLG 336

  Fly    91 -----NY---GASLRNQPQYTHWVGSGNFVQHHHYNSGNLHN-DISLIRTPHVDFWHLVNKVELP 146
                 :|   ||.:||..:.. |        |..||:.:..: ||:||            .:|.|
  Fly   337 RYDLDDYGEDGAEMRNVMRLL-W--------HPDYNTRSYSDADIALI------------TIERP 380

  Fly   147 -SYNDRYQDYAGWWAVAS----------GWGGTYDGSPLPDWLQAVDVQIMSQSDCSRTW---SL 197
             ::||.......|...||          |||...|.| ...:.:.|:.:|.|.:.|:.||   .:
  Fly   381 VTFNDIIAPICMWTVEASRTVSTTGFIAGWGRDEDSS-RTQYPRVVEAEIASPTVCASTWRGTMV 444

  Fly   198 HDNMICINTNGGKSTCGGDSGGPLVTHEGNR--LVGVTSFVSSAG-------CQSGAPAVFSRVT 253
            .:..:|.....|...|.|||||.|:..:|:|  |.|:.    |||       ||.....::..::
  Fly   445 TERSLCAGNRDGSGPCVGDSGGGLMVKQGDRWLLRGIV----SAGERGPAGTCQLNQYVLYCDLS 505

  Fly   254 GYLDWIRDN 262
            .:::||.:|
  Fly   506 KHINWISEN 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 68/279 (24%)
Tryp_SPc 38..262 CDD:238113 70/281 (25%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 66/266 (25%)
Tryp_SPc 277..511 CDD:214473 64/263 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436811
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.