DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and CG30286

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:249 Identity:67/249 - (26%)
Similarity:112/249 - (44%) Gaps:50/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 YPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGA--SLRN------ 98
            :.|:..:.|::..|  ..:|...|||:::.:.::||||||......:|:..|.  ||.:      
  Fly    39 HQAHISESPWMAYL--HKSGELVCGGTLVNHRFILTAAHCIREDENLTVRLGEFNSLTSIDCNGS 101

  Fly    99 ---QPQYTHWVGSGNF-----VQHHHYNSGNLHNDISLIRTP-------HVDFWHLVNKVELPSY 148
               .|       |.:|     .:|..|:..|..:||.|:|..       |:....|:....|...
  Fly   102 DCLPP-------SEDFEIDVAFRHGGYSRTNRIHDIGLLRLAKSVEYKVHIKPICLITNTTLQPK 159

  Fly   149 NDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSRTW--SLHDNMICINTNGGKS 211
            .:|...     .||:|||.: ........|:::.|..::...||:|:  ....:.||::...|.|
  Fly   160 IERLHR-----LVATGWGRS-PSEAANHILKSIRVTRVNWGVCSKTYWVDRRRDQICVSHESGVS 218

  Fly   212 TCGGDSGGPL---VTHEGNRL---VGVTSFVSSAGCQSGAPAVFSRVTGYLDWI 259
             |.||||||:   :..:|..|   ||:.|: .:|.|.|  |:||:.|..::|||
  Fly   219 -CSGDSGGPMGQAIRLDGRVLFVQVGIVSY-GNAECLS--PSVFTNVMEHIDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 65/247 (26%)
Tryp_SPc 38..262 CDD:238113 67/249 (27%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 67/249 (27%)
Tryp_SPc 39..268 CDD:214473 65/247 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435972
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.