DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and CG30187

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:248 Identity:67/248 - (27%)
Similarity:116/248 - (46%) Gaps:35/248 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VKIQGRITNGY-PAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGAS 95
            :.|..:||.|: .|::..| ::..:  ....::.|||::|...:|||||||.......:::.||.
  Fly    30 INIALKITGGHNAAFQNSV-WMAAV--HNRTHFICGGTLIHKRFVLTAAHCIVDQDVQSVSLGAY 91

  Fly    96 LRNQPQYTHWVGSGNFVQHHHYN-SGNLHNDISLIR-TPHVDFWHLVNKV------ELPSYNDRY 152
            .::.|.....|.:.  |.|..:: ..:..|||.|:: :..|.|..|:..:      .:.::....
  Fly    92 NKSDPADRKDVITA--VVHSSFDVRASYENDIGLLKLSSDVIFNALIRPICIVLNKSMANHMRNM 154

  Fly   153 QDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSRTWSLH--DNMICINTNGGKSTCGG 215
            :.:.     |.|| ||..|:...|.||.:.:..:.:.:|....|::  :..||.....| .||||
  Fly   155 RTFK-----AFGW-GTLRGNKTSDILQTIILNHLDREECYMELSVYPSEKQICAGVPSG-DTCGG 212

  Fly   216 DSGGPLVTHE------GNRLV--GVTSFVSSAGCQSGAPAVFSRVTGYLDWIR 260
            |||||| |::      |||.|  |:.| |....|.  ...|::.:..:.|||:
  Fly   213 DSGGPL-TNDVFIQGIGNREVQFGIIS-VGKTSCD--GQGVYTDLMSFADWIK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 64/240 (27%)
Tryp_SPc 38..262 CDD:238113 66/242 (27%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 64/240 (27%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.