DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and CG30088

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:284 Identity:73/284 - (25%)
Similarity:119/284 - (41%) Gaps:48/284 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VFLALAVAAATAIPTPEQKLVPT--PVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGG 67
            :::.:.|............|:|:  ...:..:..||..|..|.....|::..|.:|...:  |||
  Fly    10 IYICMCVCLVLQEQVAANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSSEIH--CGG 72

  Fly    68 SIIGNTWVLTAAHCTN-------GASGVTIN---YGASLRNQPQYTHWVGSGNFVQHHHYNSGNL 122
            :||.:.::||||||..       |...:|.|   .|.|.....:....|.:..:.:...:    |
  Fly    73 TIISSRYILTAAHCMRPYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFDRF----L 133

  Fly   123 HNDISLIR-------TPHVD-FWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQ 179
            .|||:|::       ..|:. ...::|....|:.:: :|        |.|||.| :.:...:.||
  Fly   134 ANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHE-FQ--------AFGWGQT-ETNHSANVLQ 188

  Fly   180 AVDVQIMSQSDCSRTWS--LHDNMICINTNGGKSTCGGDSGGPLVT---HEG---NRLVGVTSFV 236
            ...:.......|....|  :..|.:|:... |..||.|||||||||   ::|   ...:|:.|| 
  Fly   189 TTVLTRYDNRHCRSVLSMPITINQLCVGFQ-GSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSF- 251

  Fly   237 SSAGCQSGAPAVFSRVTGYLDWIR 260
            ....|||  |.|::.|..|:.|||
  Fly   252 GDDKCQS--PGVYTYVPNYIRWIR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 67/247 (27%)
Tryp_SPc 38..262 CDD:238113 69/249 (28%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 67/247 (27%)
Tryp_SPc 45..273 CDD:238113 67/247 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435973
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.