DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and CG30087

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:253 Identity:75/253 - (29%)
Similarity:115/253 - (45%) Gaps:51/253 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGA-SLRNQP 100
            |:.||..|.....|::|  ..:.|....|||||:.:.::||||||.  ...:.:..|. ::|..|
  Fly    41 RVVNGKEAVIRSAPFMV--YVTNNSLTHCGGSILNSRYILTAAHCV--FPNLRLRLGEHNIRTDP 101

  Fly   101 ------------QYTHWVGSGNFVQHHHYNSGNLHNDISLIR-------TPHVD-FWHLVNKVEL 145
                        :|    |....:.|..||:.|..|||:|::       ..|:. ...|:|....
  Fly   102 DCQGSNCSPRSEEY----GIMKAITHRFYNAANHVNDIALLKLNRSINFNVHIQPICILLNPASA 162

  Fly   146 PSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSRTWS--LHDNMICINTNG 208
            ||. ..||.:        |||.|.... .|..||..:::....:.|||::.  ::.|.||.. :.
  Fly   163 PSV-ATYQTF--------GWGETKKNG-FPHLLQTAELRAYDAAYCSRSFHAYMNGNQICAG-HE 216

  Fly   209 GKSTCGGDSGGPLVTH---EGNR---LVGVTSFVSSAGCQSGAPAVFSRVTGYLDWIR 260
            .:.||.|||||||||.   :|.:   .:|:.|: ....|||  |.|::.|..|::|||
  Fly   217 ERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSY-GPTDCQS--PGVYTYVPNYINWIR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 72/250 (29%)
Tryp_SPc 38..262 CDD:238113 74/252 (29%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 72/250 (29%)
Tryp_SPc 42..272 CDD:238113 74/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435974
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.