DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and CG30083

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:243 Identity:67/243 - (27%)
Similarity:119/243 - (48%) Gaps:34/243 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IQGRITNGYPAYEGKVPYIVGLLFSGN----GNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGA 94
            |..:|.:|..|..|..|: :..:|..|    ....|||::|...:||:||||......:.:..| 
  Fly    30 ISPKIMHGQNAENGTNPW-MAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCIKRDQILAVRLG- 92

  Fly    95 SLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDISLIR-TPHVDFWHLVNKVEL---PSYNDRYQDY 155
                :...:.:.......::.::.:|:..|||.::| .|.|.|..::..:.:   |:.....:.:
  Fly    93 ----EHSSSRYFAVTKAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRPICIITDPTKVPNVKTF 153

  Fly   156 AGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDC-SRTW-SLHDNMICINTNGGKSTCGGDSG 218
            .     |:|||.| :.......|:.|::..::.|:| :..| ::.::.||.....| .||.||||
  Fly   154 K-----AAGWGKT-ENETFSKVLKTVELNELNASECYNMLWVNVTESQICAGHPDG-DTCAGDSG 211

  Fly   219 GPLVTH----EGN-RLV--GVTSFVSSAGCQSGAPAVFSRVTGYLDWI 259
            |||: |    :|: |.|  |:.||.||. |.|  |.|::|::.::|||
  Fly   212 GPLI-HPVYMDGSLRYVQLGIISFGSSL-CNS--PGVYTRLSSFIDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 64/238 (27%)
Tryp_SPc 38..262 CDD:238113 66/239 (28%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 64/238 (27%)
Tryp_SPc 34..255 CDD:238113 64/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435965
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.