DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and CG30082

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:270 Identity:73/270 - (27%)
Similarity:109/270 - (40%) Gaps:66/270 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGV 88
            |.||        .||..|..|..|..|::..|  ..|.:..|.|::|...:|||||||.:....:
  Fly    34 LPPT--------NRIVGGRTADIGSNPWLAYL--HKNSSLVCTGTLITKRFVLTAAHCLHSFHLL 88

  Fly    89 TI---NYGASLRNQ-------PQYTHWVGSGNFVQHHHYNSG--NLHNDISLIRTPHVDFWHLV- 140
            |:   .|..|.|..       |.|..:.....::  |.:..|  :..|||.|::......:.|. 
  Fly    89 TVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYI--HTFFGGRQDSRNDIGLLKLNGTVVYKLFI 151

  Fly   141 -------NKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSRT--WS 196
                   :..::| |:..|:        |:|| |..|.......||.|::..:.||||.|:  .|
  Fly   152 RPICLFRDPGQVP-YSSTYE--------AAGW-GKIDLINTATVLQTVNLIRLDQSDCERSLRTS 206

  Fly   197 LHDNMICINTNGGK---STCGGDSGGPLVTHEGNRLV------GVTSFVSSAG---CQSGAPAVF 249
            |.....|    .|:   .||.|||||||.....|..:      |:.|:    |   |:  .|.|:
  Fly   207 LSYGQFC----AGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSY----GHYLCR--GPGVY 261

  Fly   250 SRVTGYLDWI 259
            :.|..:.:||
  Fly   262 TYVPSFTNWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 68/255 (27%)
Tryp_SPc 38..262 CDD:238113 69/256 (27%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 68/255 (27%)
Tryp_SPc 40..274 CDD:238113 69/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435975
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.930

Return to query results.
Submit another query.