DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and Cela3a

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001119790.1 Gene:Cela3a / 242711 MGIID:3651647 Length:283 Species:Mus musculus


Alignment Length:301 Identity:89/301 - (29%)
Similarity:127/301 - (42%) Gaps:64/301 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLVFLALAVAAATAIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNW-- 63
            ::||..| |.||.|:....|...  |:        .|:.||..|.....|:.|.|.:...|::  
Mouse     2 LRLLSSL-LLVALASGCGQPSHN--PS--------SRVVNGEEAVPHSWPWQVSLQYEMGGSFHH 55

  Fly    64 WCGGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQYTHWVGSGN-----------FVQHHHY 117
            .||||:|...|||||.||..    ..:||...|   .::.|.|..|:           || |..:
Mouse    56 TCGGSLITPDWVLTAGHCIM----PYLNYRVVL---GEHEHGVEEGSEQVIPINAGELFV-HPKW 112

  Fly   118 NSG--NLHNDISLIR-TPHVDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQ 179
            ||.  |..|:|:|:: :........|....||...:...:.|..:  .||||......|||..||
Mouse   113 NSECVNCGNNIALVKLSRSAQLGDAVQLACLPPAGEILPNGAPCY--ISGWGRLSTNGPLPTKLQ 175

  Fly   180 AVDVQIMSQSDCSR-TWSLH---DNMICINTNGG----------------KSTCGGDSGGPLVTH 224
            ...:.::....||| .|..|   ..|:|.   ||                .|...|||||||...
Mouse   176 QALLPVVDYEHCSRWDWWGHYVKRTMVCA---GGYIQAHSLSSDTHQPRLLSPLQGDSGGPLNCP 237

  Fly   225 EGN---RLVGVTSFVSSAGCQS-GAPAVFSRVTGYLDWIRD 261
            ..|   ::.|:.||||.:||.: ..|.:|:||:.::|||.:
Mouse   238 ADNGTWQVHGIASFVSPSGCNTLKKPTMFTRVSAFIDWIEE 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 78/261 (30%)
Tryp_SPc 38..262 CDD:238113 79/264 (30%)
Cela3aNP_001119790.1 Tryp_SPc 27..276 CDD:214473 78/261 (30%)
Tryp_SPc 28..279 CDD:238113 79/264 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.