DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and TPSD1

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:248 Identity:75/248 - (30%)
Similarity:104/248 - (41%) Gaps:45/248 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLVFLALAVAAATA--IPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNW 63
            |..|:.|||.|.|:.|  .|.|.|.|..|         .|..|..|...|.|:.|.|..  .|.:
Human     8 MLSLLLLALPVLASPAYVAPAPGQALQQT---------GIVGGQEAPRSKWPWQVSLRV--RGPY 61

  Fly    64 W---CGGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQYTH------WVGSGNFVQHHHYNS 119
            |   ||||:|...||||||||..    ..|...|:||.|.:..|      .:.....:.|..:..
Human    62 WMHFCGGSLIHPQWVLTAAHCVE----PDIKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYI 122

  Fly   120 GNLHNDISLIRTPH-VDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGS---PLPDWLQA 180
            .....||:|:.... |:....::.|.||..::.:......|  .:|||.. |.:   |.|..|:.
Human   123 IQTGADIALLELEEPVNISSHIHTVTLPPASETFPPGMPCW--VTGWGDV-DNNVHLPPPYPLKE 184

  Fly   181 VDVQIMSQSDCSRTW--SLH---------DNMICINTNGGKSTCGGDSGGPLV 222
            |:|.::....|:..:  .||         |:|:|..:....| |.||||||||
Human   185 VEVPVVENHLCNAEYHTGLHTGHSFQIVRDDMLCAGSENHDS-CQGDSGGPLV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 62/210 (30%)
Tryp_SPc 38..262 CDD:238113 62/209 (30%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 62/209 (30%)
Tryp_SPc 38..240 CDD:214473 62/209 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.