DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and try-4

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:285 Identity:75/285 - (26%)
Similarity:106/285 - (37%) Gaps:75/285 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EGKV---PYIVGLLFSGNGNWWCGGSIIGNTWVLTAAH---CTNGASG-VTINYGASLRNQPQY- 102
            |.|:   |:.|.  |:.:|....|||||....::||||   .|.|:.| :..|......|...| 
 Worm    52 ESKIKNFPWAVS--FTVDGVNRLGGSIISPYHIITAAHGFITTIGSRGNLCENKNWKKPNSSIYR 114

  Fly   103 -------THWVGSGNFVQHHHYN----------SGNLHNDISLIRT------------------- 131
                   |..|..|......|.:          |..:||.:..:..                   
 Worm   115 SIKFLRDTRKVAYGGTCIRGHTDKYPNDPRCKKSDVIHNKVRAVLVDGEFASSNCLKGHDWAIVE 179

  Fly   132 --PHVDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTY---DGSPLPDWLQAVDVQIMSQSDC 191
              ..:.|...|..:.||..|..|...    ....|||.:|   :..||   :..:.::|  ..||
 Worm   180 VEKRIHFSENVRPICLPRPNMYYTKS----LAVPGWGRSYIFNESGPL---IHEIPMRI--DRDC 235

  Fly   192 SRTWSLH-----DNMIC-----INTNGGKSTCGGDSGGPLVTHEGNR----LVGVTSFVSSAGCQ 242
            .|.||..     |:.||     ::......||.|||||.|...:.|.    |:.:||| .:.||.
 Worm   236 KRPWSDRLPADADDFICATSMNVSNYSAPRTCHGDSGGGLEYRDDNYGRAFLIAITSF-GTRGCP 299

  Fly   243 SGAPAVFSRVTGYLDWIRDNTGISY 267
            |...|.|:||..||:.|.:.||:.|
 Worm   300 SNMLARFTRVDMYLNLICNYTGVCY 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 71/275 (26%)
Tryp_SPc 38..262 CDD:238113 72/278 (26%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 72/277 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.