DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and CTRL

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001898.1 Gene:CTRL / 1506 HGNCID:2524 Length:264 Species:Homo sapiens


Alignment Length:256 Identity:87/256 - (33%)
Similarity:133/256 - (51%) Gaps:26/256 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASG-- 87
            :|.....:....||.||..|..|..|:.|.|..| :|..:||||:|..:||:||||| |.:.|  
Human    21 IPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDS-SGFHFCGGSLISQSWVVTAAHC-NVSPGRH 83

  Fly    88 --VTINYGASLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDISLIR--TPHVDFWHLVNKVELPSY 148
              |...|..|...:|...  :.....:.|..:||..::||::|::  :| ..:...::.|.|.|.
Human    84 FVVLGEYDRSSNAEPLQV--LSVSRAITHPSWNSTTMNNDVTLLKLASP-AQYTTRISPVCLASS 145

  Fly   149 NDRYQDYAGWWAVASGWG---GTYDGSPLPDWLQAVDVQIMSQSDCSRTW--SLHDNMICINTNG 208
            |:...:  |...|.:|||   |.  |:..|..||.|.:.:::.:.|.:.|  |:.|:|||.. ..
Human   146 NEALTE--GLTCVTTGWGRLSGV--GNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAG-GA 205

  Fly   209 GKSTCGGDSGGPLVTHEGNR--LVGVTSFVSSAGCQSGAPAVFSRVTGYLDWIRDNTGISY 267
            |.|:|.||||||||..:||.  |:|:.|: .:..|...||||::||:.:..||  |..|:|
Human   206 GASSCQGDSGGPLVCQKGNTWVLIGIVSW-GTKNCNVRAPAVYTRVSKFSTWI--NQVIAY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 81/234 (35%)
Tryp_SPc 38..262 CDD:238113 82/236 (35%)
CTRLNP_001898.1 Tryp_SPc 34..260 CDD:238113 83/238 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.