DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and CG43110

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:248 Identity:67/248 - (27%)
Similarity:106/248 - (42%) Gaps:39/248 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 TPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTIN 91
            |||.      :|.:|..|.:....|:.|:.  ...:..|||:||...:|||.||| .....:.:.
  Fly    31 TPVP------KIISGSNASQQSAQYMAGIF--NTTHLLCGGTIIHEDFVLTVAHC-KSTQTLFVR 86

  Fly    92 YGASLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDISLIRTPHVDFWHLVNKVELPSYND------ 150
            .||...|.|  |..:.....:.|..|::....|||:|::......::| |...:..:.|      
  Fly    87 LGAYNINHP--TDQIRVIETIAHPQYSNSTYANDIALVKLERSVIFNL-NIQPICIHLDATLGKQ 148

  Fly   151 -RYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSRTWSLHDN--MICINTNGGKST 212
             ||.:       |.|||.|.:... .|.||.:.|...:...|.....:..:  .||..|:.| .|
  Fly   149 IRYYN-------AFGWGRTRNAEQ-SDILQRIFVNRTNPMICHLYLGMSPDPKQICATTDQG-DT 204

  Fly   213 CGGDSGGPL---VTHEGNRL---VGVTSFVSSAGCQSGAPAVFSRVTGYLDWI 259
            |.|||||||   :|::|...   .|:||:.:.   :.....:::.|:.|..||
  Fly   205 CAGDSGGPLISKITYQGKNFDTQFGITSYGTR---ECNGVGLYTDVSQYSGWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 62/236 (26%)
Tryp_SPc 38..262 CDD:238113 64/237 (27%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 62/236 (26%)
Tryp_SPc 36..257 CDD:238113 64/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435983
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.