powered by:
Protein Alignment Jon99Fi and CG43124
DIOPT Version :9
Sequence 1: | NP_651800.2 |
Gene: | Jon99Fi / 43622 |
FlyBaseID: | FBgn0039778 |
Length: | 267 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001247345.1 |
Gene: | CG43124 / 12798282 |
FlyBaseID: | FBgn0262587 |
Length: | 245 |
Species: | Drosophila melanogaster |
Alignment Length: | 60 |
Identity: | 16/60 - (26%) |
Similarity: | 31/60 - (51%) |
Gaps: | 1/60 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 65 CGGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQYTHWVGSGNFVQHHHYNSGNLHN 124
|.|::|.|.:|||||.|......:|:..|:...:: .|.::..:..:....|:.:.|.:|
Fly 54 CAGALINNLYVLTAASCFKENEKLTVRLGSGYFDK-SYENFRVTKAYFWMTHFPANNTNN 112
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR24260 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.