DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and Cela1

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_291090.2 Gene:Cela1 / 109901 MGIID:95314 Length:266 Species:Mus musculus


Alignment Length:289 Identity:86/289 - (29%)
Similarity:125/289 - (43%) Gaps:57/289 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLVFLALAVAAATAIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNW-- 63
            ::.|||.:|.:...:....||            ...|:..|..|.....|..:.|.:...|:|  
Mouse     2 LRFLVFASLVLCGHSTEDVPE------------TDARVVGGAEARRNSWPSQISLQYQYGGSWHH 54

  Fly    64 WCGGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQYT-HWVGSGNFVQHHHYNSGNL--HND 125
            .|||::|.:.||:|||||.:......:..|....:|...| .:|.....|.|.::|..|:  ..|
Mouse    55 TCGGTLIRSNWVMTAAHCVDSPMTYRVVVGEHNLSQNDGTEQYVNVQKIVSHPYWNKNNVVAGYD 119

  Fly   126 ISLIRTPHVDFWHLVNKVELPSY--------------NDRYQDYAGWWAVASGWGGTYDGSPLPD 176
            |:|:|        |...|.|.:|              |:..       ...:|||.|.....|..
Mouse   120 IALLR--------LAKSVTLNNYVQLGVLPREGTILANNSP-------CYITGWGRTRTNGELAQ 169

  Fly   177 WLQAVDVQIMSQSDCSRT--W--SLHDNMICINTNGGKSTCGGDSGGPLVTH---EGNRLV-GVT 233
            .||...:..:|.|.||.:  |  |:.:.|:|...:|.:|.|.|||||||  |   .|...| |||
Mouse   170 TLQQAYLPSVSYSICSSSSYWGSSVKNTMVCAGGDGVRSGCQGDSGGPL--HCMVNGQYAVHGVT 232

  Fly   234 SFVSSAGCQ-SGAPAVFSRVTGYLDWIRD 261
            |||||.||. :..|.||:||:.|:.|:.:
Mouse   233 SFVSSMGCNVARKPTVFTRVSAYISWMNN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 79/249 (32%)
Tryp_SPc 38..262 CDD:238113 79/252 (31%)
Cela1NP_291090.2 Tryp_SPc 26..258 CDD:214473 79/248 (32%)
Tryp_SPc 27..262 CDD:238113 79/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.