DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and cela1.2

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001307331.1 Gene:cela1.2 / 100535584 ZFINID:ZDB-GENE-050208-732 Length:269 Species:Danio rerio


Alignment Length:286 Identity:83/286 - (29%)
Similarity:125/286 - (43%) Gaps:53/286 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLVFLALAVAAATAIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGN--WWC 65
            :|..|.|:|.|..|:..|..      :||:.|:.|:..|..|.....|:.:.|.:|..|.  ::|
Zfish     1 MLRILLLSVLATLALAEPRY------LKDIAIEERVVGGEIAKPHSWPWQISLQYSDLGTYYYYC 59

  Fly    66 GGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQYTH-----WVGSGNFVQHHHYNSGNL--H 123
            .|::|...||:.||||.......|:    :|.:...|||     ::.......|.::|..|:  .
Zfish    60 SGTLIRPGWVMVAAHCVEALRKWTV----ALGDHDIYTHEGPEQYISVSEVFIHPNWNPNNVAFG 120

  Fly   124 NDISLIR-------TPHVDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAV 181
            .||:|:|       :.:|....|.:..|:..|        |.....:|||.|..|..|...|:..
Zfish   121 YDIALLRLSIDATLSSYVQVATLPSSGEILPY--------GHTCYITGWGYTETGGSLSAQLKQA 177

  Fly   182 DVQIMSQSDCS-RTW---SLHDNMICINTNGGKSTCGGDSGGPL--------VTHEGNRLVGVTS 234
            .:.::....|| :.|   |:.:.|||.......|.|.||||.||        |.|      ||||
Zfish   178 YMPVVDYETCSQKDWWGSSVKETMICAGGTTSMSACHGDSGSPLNCLFNGKYVVH------GVTS 236

  Fly   235 FVSSAGCQS-GAPAVFSRVTGYLDWI 259
            |||..||.: ..|..|:||:.|::||
Zfish   237 FVSPEGCNTYKKPTGFTRVSAYINWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 71/250 (28%)
Tryp_SPc 38..262 CDD:238113 72/251 (29%)
cela1.2NP_001307331.1 Tryp_SPc 29..262 CDD:214473 71/250 (28%)
Tryp_SPc 30..265 CDD:238113 72/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434399at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.