DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and LOC100004427

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:241 Identity:75/241 - (31%)
Similarity:113/241 - (46%) Gaps:24/241 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTN--GASGVTINYGASLRNQ 99
            :|..|..|.||..|:...:.|...|.::|.||:|...||||||.|..  ..|.|.|..|....| 
Zfish    35 KIVGGLNATEGSWPWQASINFKSTGQFFCSGSLISERWVLTAASCFQRINVSDVVIYLGRLTTN- 98

  Fly   100 PQYTHWVGSGNFVQHHHYNSGNLHNDISLIR-TPHVDFWHLVNKVELPSYNDRYQDYAGWWAVAS 163
                   ||..:.........::..||:|:: :..|.|...:..|.|.:....:.|....|  .:
Zfish    99 -------GSNPYEIPRTVIQVSVTEDIALVQLSSSVTFTDYIRPVCLAAAGSVFVDGTESW--VT 154

  Fly   164 GWGGTYDGSP-LPDWLQAVDVQIMSQSDCSRTWSLH--DNMIC---INTNGGKSTCGGDSGGPLV 222
            |||.|...:. |.|.|:.|:..|::..:||....:.  ||:||   :|.. ||:.|..|.|.|||
Zfish   155 GWGSTSSTNVILSDMLKEVEAPIVNNIECSNINGITNLDNVICAGFVNET-GKAPCWEDFGSPLV 218

  Fly   223 THEGNRLV--GVTSFVSSAGCQSGAPAVFSRVTGYLDWIRDNTGIS 266
            |.:|::.:  ||..|....  |:|.|.:::||:.|.:|||:.|..|
Zfish   219 TRQGSQWIQSGVVVFTFCG--QNGFPTLYARVSEYEEWIRNYTSSS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 70/232 (30%)
Tryp_SPc 38..262 CDD:238113 73/234 (31%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 70/232 (30%)
Tryp_SPc 36..257 CDD:238113 72/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.