DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and si:dkey-238d18.3

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001373176.1 Gene:si:dkey-238d18.3 / 795978 ZFINID:ZDB-GENE-131127-38 Length:272 Species:Danio rerio


Alignment Length:275 Identity:80/275 - (29%)
Similarity:125/275 - (45%) Gaps:29/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFVFLALAVAAAT---AIPTP-----EQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSG 59
            :::...||..|:|   .:..|     ::.....|: |..|...|..|..|.  :.|:.|.:..| 
Zfish     2 IWIISFLAFVASTLGCGVRQPLGWAAKESTTKKPI-DGDIHEGIMQGVDAL--RWPWQVSIKTS- 62

  Fly    60 NGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQYTHWVGS-GNFVQHHHYNSGNL- 122
            :|...||||:|...||||||||...|....:..|...|:....|..|.. ...:.|...|...| 
Zfish    63 SGEHLCGGSLINKFWVLTAAHCQIQARSHYVVLGQHDRSSNDGTVQVKEIAKVITHPDNNIQTLF 127

  Fly   123 HNDISLIR-TPHVDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYD--GSPLPDWLQAVDVQ 184
            :||::|:: :.......||:.|.|.|.:.:.  ..|...|.:|||.|..  .:.:   ||...:.
Zfish   128 NNDVTLLKLSSPAQMTSLVSPVCLASSSSKI--VPGTLCVTTGWGRTKTELSARI---LQEATIP 187

  Fly   185 IMSQSDCSRSW---SLHDNMICINTNGGKSTCGGDSGGPLVTHEGN--RLVGVTSFVSSAGCQSG 244
            |:|||.|.:.:   .:.::|||.. ..|.|:|.|||||||:.....  ..||:.|: .:..|:..
Zfish   188 IVSQSQCKQIFGASKITNSMICAG-GSGSSSCQGDSGGPLMCESSGVWYQVGIVSW-GNRDCRVD 250

  Fly   245 APAVFSRVTGYLDWI 259
            .|.|::||:.:..||
Zfish   251 FPLVYARVSYFRKWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 70/231 (30%)
Tryp_SPc 38..262 CDD:238113 72/232 (31%)
si:dkey-238d18.3NP_001373176.1 Tryp_SPc 52..268 CDD:238113 69/222 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.