DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and Ctrb1

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_079859.2 Gene:Ctrb1 / 66473 MGIID:88559 Length:263 Species:Mus musculus


Alignment Length:249 Identity:86/249 - (34%)
Similarity:121/249 - (48%) Gaps:47/249 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQ 101
            ||.||..|..|..|:.|.|. ...|..:||||:|...||:|||||     ||            :
Mouse    33 RIVNGEDAIPGSWPWQVSLQ-DRTGFHFCGGSLISENWVVTAAHC-----GV------------K 79

  Fly   102 YTHWVGSGNFVQ-----------------HHHYNSGNLHNDISLIR--TPHVDFWHLVNKVELPS 147
            .|..|.:|.|.|                 :..:||..:.|||:|::  || ..|...|:.|.||:
Mouse    80 TTDVVVAGEFDQGSDEENVQVLKIAQVFKNPKFNSFTVRNDITLLKLATP-AQFSETVSAVCLPT 143

  Fly   148 YNDRYQDYAGWWAVASGWGGT-YDGSPLPDWLQAVDVQIMSQSDCSRSW--SLHDNMICINTNGG 209
            .:|.:.  ||.....:|||.| |:....||.||...:.|:|::.|..||  .:.|.|||...: |
Mouse   144 VDDDFP--AGTLCATTGWGKTKYNALKTPDKLQQAALPIVSEAKCKESWGSKITDVMICAGAS-G 205

  Fly   210 KSTCGGDSGGPLVTHEGN--RLVGVTSFVSSAGCQSGAPAVFSRVTGYLDWIRD 261
            .|:|.||||||||..:..  .|.|:.|: .|..|.:..|||::|||..:.|:::
Mouse   206 VSSCMGDSGGPLVCQKDGVWTLAGIVSW-GSGFCSTSTPAVYARVTALMPWVQE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 85/245 (35%)
Tryp_SPc 38..262 CDD:238113 85/248 (34%)
Ctrb1NP_079859.2 Tryp_SPc 33..256 CDD:214473 85/245 (35%)
Tryp_SPc 34..259 CDD:238113 85/248 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.