DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and CG18754

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:273 Identity:67/273 - (24%)
Similarity:102/273 - (37%) Gaps:72/273 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 TPV-KDVKIQGRITNGYP-----AYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGA 85
            ||| :|...:....|.||     .||.::..|                    .:|||||||..|.
  Fly   101 TPVFRDRGAENAELNEYPWMVLLLYENRLSLI--------------------RYVLTAAHCVIGG 145

  Fly    86 SGV-------TINYGAS----LRNQPQYTHW-VGSGNFVQHHHYNS--GNLHNDISLIRTPH-VD 135
            ...       ::..|.|    :.::.:..|. |..|....|..:.|  |...|||:|:|... |.
  Fly   146 YLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVR 210

  Fly   136 FWHLVNKV-----ELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDC-SRS 194
            :...:..:     |.|..:...|        .|||    |.:.....|....|:..:.:|| :|.
  Fly   211 YTKKIQPICLLDAEFPLQDLNLQ--------ISGW----DPTKSSQTLITSTVKERNPADCLNRY 263

  Fly   195 WSLHD-NMICINTNGGKSTCGGDSGGPLVTHEGNRLVGVTSFVSSAG--------CQS-GAPAVF 249
            .|... :.:|........||.|.||.|::...|:   ||..||..||        |.| |.|.|:
  Fly   264 PSFRSASQVCAGGQRKGDTCAGISGSPVMGIMGS---GVDEFVFLAGIASYGQQYCYSAGIPGVY 325

  Fly   250 SRVTGYLDWIRDN 262
            :::..:.:||:.|
  Fly   326 TKIGHFSEWIKAN 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 60/257 (23%)
Tryp_SPc 38..262 CDD:238113 62/259 (24%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 62/264 (23%)
Tryp_SPc 108..335 CDD:214473 60/261 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435987
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.