DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and ctrb.3

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001017724.1 Gene:ctrb.3 / 550419 ZFINID:ZDB-GENE-050417-229 Length:265 Species:Danio rerio


Alignment Length:269 Identity:98/269 - (36%)
Similarity:128/269 - (47%) Gaps:26/269 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVFLALAVA---AATAIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWC 65
            |::|...||   ||.....|   .:| ||  |....||.||..|.....|:.|.|. ...|..:|
Zfish     3 FLWLLSCVAFFSAAYGCGVP---AIP-PV--VSGYARIVNGEEAVPHSWPWQVSLQ-DFTGFHFC 60

  Fly    66 GGSIIGNTWVLTAAHCTNGASGVTI----NYGASLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDI 126
            |||:|...||:|||||:...|...|    |.|.|  |..:....:.......|..|||..:.|||
Zfish    61 GGSLINEFWVVTAAHCSVRTSHRVILGEHNKGKS--NTQEDIQTMKVSKVFTHPQYNSNTIENDI 123

  Fly   127 SLIR-TPHVDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGGT-YDGSPLPDWLQAVDVQIMSQS 189
            :|:: |........|:.|.|...:|.:.  :|...|.||||.| |:....||.||.|.:.::|..
Zfish   124 ALVKLTAPASLNAHVSPVCLAEASDNFA--SGMTCVTSGWGVTRYNALFTPDELQQVALPLLSNE 186

  Fly   190 DCSRSW--SLHDNMICINTNGGKSTCGGDSGGPLVTHEGN--RLVGVTSFVSSAGCQSGAPAVFS 250
            ||...|  ::.|.|||... .|.|:|.||||||||..:.|  .|||:.|:.||. |....|.|:.
Zfish   187 DCKNHWGSNIRDTMICAGA-AGASSCMGDSGGPLVCQKDNIWTLVGIVSWGSSR-CDPTMPGVYG 249

  Fly   251 RVTGYLDWI 259
            |||...||:
Zfish   250 RVTELRDWV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 86/231 (37%)
Tryp_SPc 38..262 CDD:238113 86/232 (37%)
ctrb.3NP_001017724.1 Tryp_SPc 33..258 CDD:214473 86/231 (37%)
Tryp_SPc 34..261 CDD:238113 86/232 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.