DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and ctrl

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001015686.1 Gene:ctrl / 548358 XenbaseID:XB-GENE-5876074 Length:263 Species:Xenopus tropicalis


Alignment Length:240 Identity:84/240 - (35%)
Similarity:122/240 - (50%) Gaps:26/240 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTI-------NYGA 94
            ||.||..|..|..|:.|.|..| .|..:||||:|.:.||:|||||     |||.       .|..
 Frog    33 RIVNGENAVPGSWPWQVSLQDS-TGFHFCGGSVISDFWVVTAAHC-----GVTTAHRVILGEYDR 91

  Fly    95 SLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDISLIR-TPHVDFWHLVNKVELPSYNDRYQDYAGW 158
            |...:|..|..:  ....:|.:|||..:.|||:|:: :....|.::|..|.:.|.:|.:.  .|.
 Frog    92 SSPAEPIQTKTI--AKVFRHPNYNSFTIANDITLLKLSSPASFSNIVAPVCVASSSDAFN--GGE 152

  Fly   159 WAVASGWGGTYDGSPL-PDWLQAVDVQIMSQSDCSRSW--SLHDNMICINTNGGKSTCGGDSGGP 220
            ..|.:|||.....|.| |:.||.|.:.::|.::|.|.|  .:.:.|:|...:|. |:|.||||||
 Frog   153 RCVTTGWGYVDAASRLTPNKLQQVALPLLSNTECQRYWGSKILNTMVCAGASGA-SSCMGDSGGP 216

  Fly   221 LVTHEGNR--LVGVTSFVSSAGCQSGAPAVFSRVTGYLDWIRDNT 263
            ||......  |.|:.|:.||. |...:|.|::||:....|: |.|
 Frog   217 LVCQRNGAWVLAGIVSWGSST-CSPSSPGVYARVSTLRSWM-DQT 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 81/234 (35%)
Tryp_SPc 38..262 CDD:238113 81/236 (34%)
ctrlNP_001015686.1 Tryp_SPc 34..259 CDD:238113 82/237 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.