DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and CG11841

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:326 Identity:77/326 - (23%)
Similarity:134/326 - (41%) Gaps:86/326 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFLALAVAAATA---IPTPEQKLVPTPVKDVKIQGR------------------------- 37
            ::|.:.|..:::::..   .|.|..:|..|..|.:..:.|                         
  Fly     6 LELILLLVFSLSSSLVQGQNPDPFAQLACTKFKQIVFEERVAISFFFTDAPITYETVDSCHGSRP 70

  Fly    38 -ITNGYPAYEGKVPYIVGLLFSGNGN---WWCGGSIIGNTWVLTAAHC---TNGASGVT----IN 91
             |.:|.||...:.|:...|......|   |:|||::|.|..|||||||   .:|...|.    :.
  Fly    71 LIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELE 135

  Fly    92 YGASLRN-QPQYTHWVGSGNFVQHHHYNSGNLHNDISLIRTP-HVDFWHLVNKVELPS---YNDR 151
            :.....: :|:.   .|......|..:.:..|:|||.:::.. .|.|    |:.:.|:   ::|.
  Fly   136 FDTDTDDAEPED---FGVLALKAHPGFENPQLYNDIGIVQLDREVKF----NRYKHPACLPFDDG 193

  Fly   152 YQDYAGWWAVASGWG----GTYDGSPLPDWLQAVDVQIMSQSD-CSRSWSLHDNM---------I 202
            .|..:   .:|.|||    ...:...|      :.||:....| |..|...:|.:         :
  Fly   194 EQHES---FIAIGWGQKKFAQKESKKL------LKVQLQGYKDRCVSSVDANDELPNGYEPKSQL 249

  Fly   203 CINTNGGKSTCGGDSGGPLVTHEGN-----RLVGVTSFVSSAG--CQS-GAPAVFSRVTGYLDWI 259
            ||.:...|.||.||||||::.:..:     .::|:|    |||  |.: ..|:.::||..:|:||
  Fly   250 CIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGIT----SAGITCSTPDIPSAYTRVHYFLNWI 310

  Fly   260 R 260
            :
  Fly   311 K 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 68/284 (24%)
Tryp_SPc 38..262 CDD:238113 69/260 (27%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 68/258 (26%)
Tryp_SPc 72..310 CDD:214473 67/257 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437132
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.