DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and CG5255

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:282 Identity:85/282 - (30%)
Similarity:124/282 - (43%) Gaps:45/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFVFLALAV---AAATAIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWW 64
            |.:.|.|.:   :||:.|..|.|          ..:.||..|..|..|..||.:.|...|:|...
  Fly     2 LLILLPLVLFTSSAASQILYPPQ----------YTKNRIVGGEEAAAGLAPYQISLQGIGSGAHS 56

  Fly    65 CGGSIIGNTWVLTAAHCTNG--ASGVTINYGASLRNQPQYTHWVGS-----GNFVQHHHYNSGNL 122
            |||:||...|::||||||.|  |:...:..|.      |..|..||     ...|:|.:|.....
  Fly    57 CGGAIIDERWIITAAHCTRGRQATAFRVLTGT------QDLHQNGSKYYYPDRIVEHSNYAPRKY 115

  Fly   123 HNDISLIR-TPHVDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIM 186
            .|||:|:. ...:.|.:....|||    |......|...:.:|||....|..:|..||:::|..:
  Fly   116 RNDIALLHLNESIVFDNATQPVEL----DHEALVPGSRLLLTGWGTLSLGGDVPARLQSLEVNYV 176

  Fly   187 SQSDCSRSWSLHDNM-------ICINTNGGKSTCGGDSGGPLVTHEGNRLVGVTSFVSSAGCQSG 244
            ....|.   :.|||.       :|...:.|:..|.|||||||| |.| :||.:.::  ...|..|
  Fly   177 PFEQCR---AAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLV-HNG-KLVALVNW--GLPCAKG 234

  Fly   245 APAVFSRVTGYLDWIRDNTGIS 266
            .|...:.::.|.|:||.:..:|
  Fly   235 YPDAHASISYYHDFIRTHLSLS 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 74/236 (31%)
Tryp_SPc 38..262 CDD:238113 75/238 (32%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 74/236 (31%)
Tryp_SPc 30..252 CDD:238113 75/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436821
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.