DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and CG4053

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:249 Identity:79/249 - (31%)
Similarity:110/249 - (44%) Gaps:47/249 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IQGRITNGYPAYEGKVPYIVGLLFSGNGNWW----CGGSIIGNTWVLTAAHCTNGAS--GVTINY 92
            :..||..|..|.:|..||.|.:     ...|    |.|.|:...|:|||.||....|  .:.|..
  Fly    31 LDNRIVGGQEAEDGVAPYQVSI-----QTIWKTHICSGVILNEQWILTAGHCALDFSIEDLRIIV 90

  Fly    93 GASLRNQPQYT--------HWVGSGNFVQHHHYNSGNLHNDISLIRTPHVDFWHLVNK----VEL 145
            |.:.|.:|..|        |.:....:|    ||     |||:||   ||:...:.|.    |||
  Fly    91 GTNDRLEPGQTLFPDEALVHCLYDIPYV----YN-----NDIALI---HVNESIIFNDRTQIVEL 143

  Fly   146 PSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSRSWSLHDNM----ICINT 206
                .|.|..||.....:|||......|...:||.:::.|::..:|...|..||.:    ||..|
  Fly   144 ----SREQPPAGSTVTLTGWGAPESSYPTVQYLQTLNLTIIAHEECRERWDFHDGIDIGHICTFT 204

  Fly   207 NGGKSTCGGDSGGPLVTHEGNRLVGVTSFVSSAGCQSGAPAVFSRVTGYLDWIR 260
            ..|:..|.|||||||: .|| :|||:.::  ...|..|.|.:::....|.||||
  Fly   205 REGEGACSGDSGGPLM-WEG-KLVGLVNW--GRACGVGMPDMYANTVYYQDWIR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 76/243 (31%)
Tryp_SPc 38..262 CDD:238113 78/245 (32%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 76/243 (31%)
Tryp_SPc 35..256 CDD:238113 78/245 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.