DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and CG9649

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:281 Identity:68/281 - (24%)
Similarity:118/281 - (41%) Gaps:74/281 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNG---NWWCGGSIIGNTWVLTAAHC-- 81
            :|::.||.        |.||.....|::|::.. ||...|   |:.|||::|....|::||||  
  Fly   249 EKVIQTPF--------IHNGIEVERGQLPWMAA-LFEHVGRDYNFLCGGTLISARTVISAAHCFR 304

  Fly    82 -------------TNGASGVTI-NYGASLRNQPQYTHWVGSGNFVQHHHYNSGNLHN--DISLIR 130
                         :.|.:.:.: :.||:|          |....:.|..||. |::.  |::|::
  Fly   305 FGSRNLPGERTIVSLGRNSLDLFSSGATL----------GVARLLIHEQYNP-NVYTDADLALLQ 358

  Fly   131 -TPHVD---------FWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQI 185
             :.|||         .|:....:||||.:..|         .:|||....|:......:..|..|
  Fly   359 LSNHVDIGDYIKPICLWNENFLLELPSGHKSY---------VAGWGEDEKGNRNTRLAKMTDTDI 414

  Fly   186 MSQSDCSRSWS------LHDNMICINTNGGKSTCGGDSGGPLVTHEGNRLVGVTSFVSSAG---- 240
            ::|.:|..:.|      :..:.||.:.......|.|||||.|:..|.:  :.:...|.|||    
  Fly   415 ITQWECRGNLSEENAKFITSHTICASNAQASGPCSGDSGGGLMLQEQD--IWMLRGVVSAGQRMT 477

  Fly   241 --CQSGAPAVFSRVTGYLDWI 259
              |....|.:::.|..:::|:
  Fly   478 NRCNLTLPVIYTDVAKHIEWL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 64/264 (24%)
Tryp_SPc 38..262 CDD:238113 65/265 (25%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 64/263 (24%)
Tryp_SPc 259..497 CDD:214473 63/260 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471107
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.