DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and CG8870

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:274 Identity:66/274 - (24%)
Similarity:110/274 - (40%) Gaps:80/274 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EGKVPYI-----VGLLFSGNGNWW-------CGGSIIGNTWVLTAAHCTN--------------- 83
            :||:|.:     :.:|..||.|..       ||||:|.|.:|||||||..               
  Fly    86 KGKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRL 150

  Fly    84 GASGVTINYGASLRN-----QPQYTHWVGSGNFVQHHHYNSG-NLHNDISLIRTPH-VDFWHLVN 141
            |....:.|...::.|     .|.|.. :.....:.|..:|.| .|.|||:|:|... |.:...:.
  Fly   151 GEHNTSTNPDRAIVNGRRQYAPLYME-IEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQ 214

  Fly   142 KVELP------SYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQS--------DCS 192
            .:.||      ::..::|        ||||         ||..|.:..:::.:|        .|.
  Fly   215 PICLPRAQKLAAHKRKFQ--------ASGW---------PDMGQGIASEVLLRSFIAERHPDVCK 262

  Fly   193 RSWSLH-DNMICINTNGGKSTCGGDSGGPLVTHEGNRLVGVTSFVSSAG--------C--QSGAP 246
            .::..: .:.||.....|..|..|||||||:.   ..:.|..:...:||        |  ::..|
  Fly   263 SNYDFNLGSQICAGGLDGNDTSPGDSGGPLME---TVIRGKVTLTYAAGIISYGQKPCVLKTCKP 324

  Fly   247 AVFSRVTGYLDWIR 260
            |.:::.:.:.:||:
  Fly   325 AFYTKTSYFFEWIK 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 64/271 (24%)
Tryp_SPc 38..262 CDD:238113 66/274 (24%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 63/267 (24%)
Tryp_SPc 93..337 CDD:214473 61/264 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435992
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.