DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and CG13318

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:268 Identity:73/268 - (27%)
Similarity:113/268 - (42%) Gaps:49/268 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGAS 86
            ::..|.|.......|:.:.|  ||    |:...||.:.: .:..||::|....||||||..... 
  Fly   153 RRFPPPPGSTTAAPGQASFG--AY----PWQAALLTTAD-VYLGGGALITAQHVLTAAHKVYNL- 209

  Fly    87 GVTI------NYGASLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDISLIR--TP-HVDFWHLVNK 142
            |:|.      .:.|:..::|.....|...|...:..:|..||.||:::::  || .:.....|..
  Fly   210 GLTYFKVRLGEWDAASTSEPIPAQDVYISNVYVNPSFNPNNLQNDVAILKLSTPVSLTSKSTVGT 274

  Fly   143 VELPSYNDRYQDYAGWWAVASGWG-------GTYDGSPLPDWLQAVDVQIMSQSDC--------- 191
            |.||:     ..:.|.....:|||       |.|....     :.|||.::..::|         
  Fly   275 VCLPT-----TSFVGQRCWVAGWGKNDFGATGAYQAIE-----RQVDVPLIPNANCQAALQATRL 329

  Fly   192 SRSWSLH-DNMICINTNGGKSTCGGDSGGPLV-THEGN-RLVGVTSFVSSAGC-QSGAPAVFSRV 252
            ..|:.|. .:.||.....||..|.||.|.||| |..|. .:||:.::  ..|| |:|.|.|:..|
  Fly   330 GSSFVLSPTSFICAGGEAGKDACTGDGGSPLVCTSNGVWYVVGLVAW--GIGCAQAGVPGVYVNV 392

  Fly   253 TGYLDWIR 260
            ..||.||:
  Fly   393 GTYLPWIQ 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 68/250 (27%)
Tryp_SPc 38..262 CDD:238113 70/252 (28%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 70/252 (28%)
Tryp_SPc 169..399 CDD:214473 68/249 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435429
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.