DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and CG18223

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:247 Identity:61/247 - (24%)
Similarity:106/247 - (42%) Gaps:64/247 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YIVGL-------LFSGNGNWWCGGSIIGNTWVLTAAHC--------------------TN---GA 85
            |:|.:       ||  ..|.:|||.||..|::||:|||                    ||   ..
  Fly    60 YVVSIRSRRPHKLF--GDNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSR 122

  Fly    86 SGVTINYGASLRNQP-QYTHWVGSGNFVQHHHYNSGNLHNDISLIRTPHVDFWHLVNKVELPSYN 149
            .|:::|........| ::|            .:|:.|:...:...:.|..:  .||..:.||:.:
  Fly   123 KGLSLNMEVKKIFVPDKFT------------VFNTNNIALMMLAKKLPLDN--PLVGVINLPTAD 173

  Fly   150 DRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSRSWSLH---DNMIC---INTNG 208
            ..    .|......|||..:.|.||...:..:||:::.:..|.:  .:|   :.|:|   :|...
  Fly   174 PE----PGLNYTVLGWGRIFKGGPLASDILHIDVELLPRDICEK--KVHIFKEEMMCAGNLNNTM 232

  Fly   209 GKSTCGGDSGGPLVTHEGNRLVGVTSFVSSAGCQSGA-PAVFSRVTGYLDWI 259
            .::.|.||:|.||:.:|  .:.||.|:  ..||.|.. |::::.|..::|||
  Fly   233 DENPCAGDTGSPLIFNE--TVFGVVSY--RVGCGSKTLPSIYTNVYMHMDWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 59/245 (24%)
Tryp_SPc 38..262 CDD:238113 61/247 (25%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 61/247 (25%)
Tryp_SPc 60..280 CDD:214473 59/245 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436819
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.