DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and CG3088

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:272 Identity:125/272 - (45%)
Similarity:169/272 - (62%) Gaps:25/272 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLF-VFLALA-VAAATAIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNW 63
            |||. |||.|. |||.:|....|.   |..:        ||||.|||||:.||:||:.| |..|.
  Fly     1 MKLLVVFLGLTLVAAGSAKKDSED---PDHI--------ITNGSPAYEGQAPYVVGMAF-GQSNI 53

  Fly    64 WCGGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDISL 128
            ||.|:|||:||:||:|.|..|:|||||.:||:..:|.|:|..||:..:|      :||.|  ::|
  Fly    54 WCSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQFTVTVGTSEYV------TGNQH--LAL 110

  Fly   129 IRTPHVDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSR 193
            :|.|.|.|.:.||:|.|||..:|.|.|..|||...|||.|...:.|.|.||.||:||||.::|..
  Fly   111 VRVPRVGFSNRVNRVALPSLRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNNECIA 175

  Fly   194 ---SWSLHDNMICINTNGGKSTCGGDSGGPLVTHEGNRLVGVTSFVSSAGCQSGAPAVFSRVTGY 255
               |.::.|.::|..|..|:|||.||:|.||:|.:.:.:||:::||:|.||..|.||.|:|:|..
  Fly   176 FYGSTTVSDQILCTRTPSGRSTCFGDAGSPLITKQDSTVVGISAFVASNGCTLGLPAGFARITSA 240

  Fly   256 LDWIRDNTGISY 267
            ||||...|||:|
  Fly   241 LDWIHQRTGIAY 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 106/224 (47%)
Tryp_SPc 38..262 CDD:238113 108/226 (48%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 108/225 (48%)
Tryp_SPc 29..244 CDD:214473 106/223 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470802
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.