DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and CG33460

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:244 Identity:51/244 - (20%)
Similarity:96/244 - (39%) Gaps:58/244 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASLR--NQPQYTHWVGSGNFVQHHHYN 118
            |...:|:.:|.|::|.:.::||||.|.. .:.|.:..|...|  |:....|.|  ..|:.:..:|
  Fly    48 LLHTDGSIFCAGTLITDVFILTAASCIR-PNAVKVRLGEFGRYPNELPEDHLV--HYFLMYRLFN 109

  Fly   119 SGNLHNDISLIRTPHVDFWHLVNKVELPSY--------NDRYQDYAGWWAVASGWGGTYDGSPLP 175
            :.:|.|:|.|::        |..:|::..|        |.:.|..:....:.:.|   .:.|.:.
  Fly   110 NESLANNIGLLK--------LTKRVQITDYIMPVCIVLNPQNQQLSTMRFIGNAW---MEDSNVS 163

  Fly   176 DWLQAVDVQIMSQSDCSRSWSLHDNMICINTNGGKSTCGGDSGGPLVTHEGNRLV--------GV 232
            ...:...:.|.|:.....:..|: ...|....|...:|.|.:|..|:  :.:|.:        |:
  Fly   164 LTKELRPIVIQSKPKMCTNLDLY-TQFCAGHQGNLRSCDGLTGSALI--QNSRYMNKYRHIQFGI 225

  Fly   233 TSFVSSAGCQSGAPAVFSRVTGYLD------WIRD--------NTGISY 267
            .: |:...|:..        .||.|      ||:|        :|..||
  Fly   226 AT-VNDMDCEES--------QGYTDVLKFYWWIQDVVSLFNHYSTNESY 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 45/226 (20%)
Tryp_SPc 38..262 CDD:238113 48/237 (20%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 47/229 (21%)
Tryp_SPc 44..249 CDD:214473 45/226 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436004
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.