DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and CG33465

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:267 Identity:63/267 - (23%)
Similarity:106/267 - (39%) Gaps:55/267 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASG 87
            :|:.....|.|....|...:.|.| ..|::..:.  .|..:.|.|:::...:|||||.|.:..|.
  Fly    20 QLLDKKCHDPKTSENINFNHGATE-TAPWMASIY--KNNQFICDGTLVHKLFVLTAASCISKDSQ 81

  Fly    88 VTINYG--------ASLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDISLIRT-------PHV--- 134
            :.:.:|        :...|..||    |....:||.::...|..|||.|:|.       .|:   
  Fly    82 LYVLFGMYNQYRDASQFFNNEQY----GVAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAHIRPI 142

  Fly   135 ----DFWHLVNKVELPSYNDRYQDYAGWWAVASGW--GGTYDGSPLPDWLQAVDVQIMSQSDCSR 193
                |  |:|.....    :|::.:        ||  .||...|.:   .|.|.:......:|.|
  Fly   143 CIILD--HVVKSAPF----ERFEGF--------GWQQQGTEASSQV---RQTVYLSQKKPFECHR 190

  Fly   194 SWSL---HDNMICINTNGGKSTCGGDSGGPLVTH--EGNRLVGVTSFVSSAGCQSGAP-AVFSRV 252
            :..|   ::...|.. |..:|.|..:||.||...  .|.:.:.|...:.|.|.:..:| :|::.|
  Fly   191 NGQLLPINEGQFCAG-NRDRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCSPTSVYTDV 254

  Fly   253 TGYLDWI 259
            ..:.|||
  Fly   255 VAFKDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 58/251 (23%)
Tryp_SPc 38..262 CDD:238113 60/252 (24%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 57/240 (24%)
Tryp_SPc 46..261 CDD:214473 55/238 (23%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436013
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.