DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and CG10764

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:287 Identity:80/287 - (27%)
Similarity:122/287 - (42%) Gaps:55/287 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFLALAVAAATAIPTPEQ-KLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWW 64
            |:..|.:||.......:...|. |.:.||. .:..:.:|:.|..|.|....::..:.  .:.::.
  Fly     1 MRSLVSVALLSLLTLCVTENEHFKFLETPC-GISTRPKISGGDDAAEPNSIWMAAIF--NSSDFQ 62

  Fly    65 CGGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDISLI 129
            |||:||...:||:||||......:.:..||...|:|...|.|  .|...||.:.:....|||.|:
  Fly    63 CGGTIIHMRFVLSAAHCLVRGYDLYVRLGARNINEPAAVHTV--INVFVHHDFIASEYRNDIGLL 125

  Fly   130 RTPHVDFWHLVNKVELPSYNDRYQ------DYAGWWAV-------ASGWGGTYDGSPLPDWLQAV 181
            :..           |...|..|.|      |.|...:|       |.|||..  ...|...||.:
  Fly   126 QLS-----------ESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWGNR--NGKLSIMLQTI 177

  Fly   182 DVQIMSQSDCSR--SWSLHDNMICINTNGGKSTCGGDSGGPLVTH---EGNR----LVGVTSFVS 237
            .:..:.:::|.|  :::|:...||..|..| .||.|||||||.|:   ..|:    .:|:.||  
  Fly   178 YLLHLKRNECKRKLNFNLNSRQICAGTKNG-DTCRGDSGGPLSTNILFPSNKSYEVQLGIVSF-- 239

  Fly   238 SAGCQSGAP-----AVFSRVTGYLDWI 259
                  |.|     .|::.||.|:|||
  Fly   240 ------GDPECRGVGVYTDVTSYVDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 70/248 (28%)
Tryp_SPc 38..262 CDD:238113 72/249 (29%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 70/248 (28%)
Tryp_SPc 38..263 CDD:238113 72/249 (29%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436014
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.