DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and Ctrc

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001071117.1 Gene:Ctrc / 362653 RGDID:1308379 Length:268 Species:Rattus norvegicus


Alignment Length:264 Identity:78/264 - (29%)
Similarity:114/264 - (43%) Gaps:49/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNW--WCGGSIIGNTWVLTAAHCTNGASGVTI 90
            |.....:..|:..|..|.....|:.|.|.:..:..|  .||||:|..:.|||||||.|       
  Rat    20 PAFPPNLSTRVVGGEDAVPNSWPWQVSLQYLKDDTWRHTCGGSLITTSHVLTAAHCIN------- 77

  Fly    91 NYGASLRNQPQYTHWVGSGNF------------------VQHHHYNSGNLHNDISLIRTPH-VDF 136
                     ..:|:.||.|.:                  ..|..:|...|.|||::|:... |:.
  Rat    78 ---------KDFTYRVGLGKYNLTVEDEEGSVYAEVDTIYVHEKWNRLFLWNDIAIIKLAEPVEL 133

  Fly   137 WHLVNKVELPSYNDRY-QDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSR-SW---S 196
            .:.:....:|...... |||.   ...:|||..:...|:.:.||.....|:|.:.||| .|   .
  Rat   134 SNTIQVACIPEEGSLLPQDYP---CYVTGWGRLWTNGPIAEVLQQGLQPIVSHATCSRLDWWFIK 195

  Fly   197 LHDNMICINTNGGKSTCGGDSGGPL--VTHEGN-RLVGVTSFVSSAGCQ-SGAPAVFSRVTGYLD 257
            :...|:|...:|..|.|.|||||||  ...:|: ::.|:.||.||:||. ...|.||:||:.|.|
  Rat   196 VRKTMVCAGGDGVISACNGDSGGPLNCQAEDGSWQVHGIVSFGSSSGCNVHKKPVVFTRVSAYND 260

  Fly   258 WIRD 261
            ||.:
  Rat   261 WINE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 75/251 (30%)
Tryp_SPc 38..262 CDD:238113 76/254 (30%)
CtrcNP_001071117.1 Tryp_SPc 29..262 CDD:214473 75/251 (30%)
Tryp_SPc 30..265 CDD:238113 76/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBU3
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.