DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and PRSS41

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:248 Identity:77/248 - (31%)
Similarity:108/248 - (43%) Gaps:48/248 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 IVGLLFSGNGNW-W-----------CGGSIIGNTWVLTAAHCTNG---ASGVTINYGASLRNQPQ 101
            :.|.:.|..|.| |           ||||::...|||:||||...   .|..|:..| .|.::| 
Human    71 VAGGVESARGRWPWQASLRLRRRHRCGGSLLSRRWVLSAAHCFQKHYYPSEWTVQLG-ELTSRP- 133

  Fly   102 YTHW----VGSGNFVQHHHYNS---GNLHNDISLIR-TPHVDFWHLVNKVELPSYNDRYQDYAGW 158
             |.|    ..|...||....|.   |.|.|||:|:| ...|.:...:..:.:.|....:......
Human   134 -TPWNLRAYSSRYKVQDIIVNPDALGVLRNDIALLRLASSVTYNAYIQPICIESSTFNFVHRPDC 197

  Fly   159 WAVASGWG-GTYDGSPLPD--WLQAVDVQIMSQSDC--------SRS--WSLHDNMICINT-NGG 209
            |  .:||| .:..|:|||.  .|:...|.|::.:.|        |||  |   |:|.|... :|.
Human   198 W--VTGWGLISPSGTPLPPPYNLREAQVTILNNTRCNYLFEQPSSRSMIW---DSMFCAGAEDGS 257

  Fly   210 KSTCGGDSGGPLVTHEGN--RLVGVTSFVSSAGCQSGAPAVFSRVTGYLDWIR 260
            ..||.||||||||..:..  ..||:.|:....| |...|.|::.::.|..|||
Human   258 VDTCKGDSGGPLVCDKDGLWYQVGIVSWGMDCG-QPNRPGVYTNISVYFHWIR 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 74/245 (30%)
Tryp_SPc 38..262 CDD:238113 77/248 (31%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.