DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and PRSS48

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_011530223.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:351 Species:Homo sapiens


Alignment Length:269 Identity:75/269 - (27%)
Similarity:111/269 - (41%) Gaps:67/269 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQP- 100
            |:..|..|..|:.|:.|.|.|  :.|:.||||::....:||||||.                || 
Human    50 RVVGGQDAAAGRWPWQVSLHF--DHNFICGGSLVSERLILTAAHCI----------------QPT 96

  Fly   101 ----QYTHWVGS--------------GNFVQHHHYNSGNLHNDISLIR-TPHVDFWHLVNKVELP 146
                .||.|:||              ...|.|..|.....  |::|:: :..|.|...:..:.||
Human    97 WTTFSYTVWLGSITVGDSRKRVKYYVSKIVIHPKYQDTTA--DVALLKLSSQVTFTSAILPICLP 159

  Fly   147 SYNDRYQDYAGWWAVASGWGGTYDGSPLPDW---LQAVDVQIMSQSDCSRSWS------------ 196
            |...:.......|  .:|||...:.|. .|:   ||..:|.|:.:..|.:.::            
Human   160 SVTKQLAIPPFCW--VTGWGKVKESSD-RDYHSALQEAEVPIIDRQACEQLYNPIGIFLPALEPV 221

  Fly   197 LHDNMICI-NTNGGKSTCGGDSGGPLVTH-EGNRLVGVTSFVSSAG--CQSGAPAVFSRVTGYLD 257
            :.::.||. :|...|.:|.|||||||..| :|   |.:.:.|.|.|  |....|.|::.|..|..
Human   222 IKEDKICAGDTQNMKDSCKGDSGGPLSCHIDG---VWIQTGVVSWGLECGKSLPGVYTNVIYYQK 283

  Fly   258 WIRDNTGIS 266
            ||  |..||
Human   284 WI--NATIS 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 70/260 (27%)
Tryp_SPc 38..262 CDD:238113 71/262 (27%)
PRSS48XP_011530223.1 Tryp_SPc 50..285 CDD:214473 70/260 (27%)
Tryp_SPc 51..288 CDD:238113 72/264 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.