DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and psh

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:256 Identity:70/256 - (27%)
Similarity:116/256 - (45%) Gaps:49/256 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ITNGYPAYEGKVPYI--VGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVT--INYGASLRN 98
            |..|||...|..|::  :|.:..|. ::.||||:|.:.:|||||||.|..:...  :..||....
  Fly   144 IVGGYPVDPGVYPHMAAIGYITFGT-DFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNIE 207

  Fly    99 QPQYTHWVGSGNFVQHHHYNSGNLHNDISL-------IRTPHVDFWHLVNKVELPSYNDRYQDYA 156
            .|.:::.......|:.|....||.:|||::       :.|.::....|......|..|.::    
  Fly   208 NPDHSYQDIVIRSVKIHPQYVGNKYNDIAILELERDVVETDNIRPACLHTDATDPPSNSKF---- 268

  Fly   157 GWWAVASGWG----GTYDGSPLPDWLQAVDVQIMSQSDCSRSWS------------LHDNMIC-I 204
                ..:|||    .|...|.:   |....::::....|:.|::            :.|:::| |
  Fly   269 ----FVAGWGVLNVTTRARSKI---LLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCAI 326

  Fly   205 NTNGGKSTCGGDSGGPLVTHEGN------RLVGVTSFVSSAGCQSGAPAVFSRVTGYLDWI 259
            :.......|.|||||||: ||.|      .::||.|  |..||.:..|.:::||:.|||:|
  Fly   327 DQKLIADACKGDSGGPLI-HELNVEDGMYTIMGVIS--SGFGCATVTPGLYTRVSSYLDFI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 69/254 (27%)
Tryp_SPc 38..262 CDD:238113 70/256 (27%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 69/254 (27%)
Tryp_SPc 144..387 CDD:238113 70/256 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437005
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.