DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and ctrb.1

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_997783.1 Gene:ctrb.1 / 322451 ZFINID:ZDB-GENE-030131-1171 Length:263 Species:Danio rerio


Alignment Length:275 Identity:101/275 - (36%)
Similarity:133/275 - (48%) Gaps:33/275 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFVFLALAVAAAT------AIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNG 61
            |::...||...|.      |||         ||  |....||.||..|.....|:.|.|..| .|
Zfish     4 LWILSCLAFFGAAYGCGIPAIP---------PV--VTGYARIVNGEEARPHSWPWQVSLQDS-TG 56

  Fly    62 NWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDI 126
            ..:||||:|...||:|||||....|...|.......:..:....:..|..::|.:|||..::|||
Zfish    57 FHFCGGSLINENWVVTAAHCNVRTSHRVILGEHDRSSNAEAIQTIAVGKSIKHPNYNSFTINNDI 121

  Fly   127 SLIR--TPHVDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGGT-YDGSPLPDWLQAVDVQIMSQ 188
            .||:  ||.....| |:.|.|...||.:.  .|...|.||||.| |:....|..||...:.:::.
Zfish   122 LLIKLATPAKINTH-VSPVCLAETNDNFP--GGMKCVTSGWGLTRYNAPDTPALLQQAALPLLTN 183

  Fly   189 SDCSRSW--SLHDNMICINTNGGKSTCGGDSGGPLVTHEGNR---LVGVTSFVSSAGCQSGAPAV 248
            .||.|.|  ::.|.|||...: |.|:|.||||||||. |.||   |||:.|:.||. |.:..|||
Zfish   184 DDCKRYWGTNITDLMICAGAS-GVSSCMGDSGGPLVC-ENNRVWTLVGIVSWGSST-CSTSTPAV 245

  Fly   249 FSRVTGYLDWIRDNT 263
            ::|||....|: |.|
Zfish   246 YARVTKLRAWV-DQT 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 88/229 (38%)
Tryp_SPc 38..262 CDD:238113 88/231 (38%)
ctrb.1NP_997783.1 Tryp_SPc 33..256 CDD:214473 88/229 (38%)
Tryp_SPc 34..259 CDD:238113 89/232 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.