DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and CG31269

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:260 Identity:79/260 - (30%)
Similarity:120/260 - (46%) Gaps:53/260 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VKIQG-----------RITNGYPAYEGKVPYIVGLLFSG-NGNWWCGGSIIGNTWVLTAAHCTNG 84
            ::|:|           ||..|..|.:|..||.:.|  .| :|...|||:||..|:|||||||...
  Fly    21 IRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISL--QGISGAHSCGGAIINETFVLTAAHCVEN 83

  Fly    85 A--SGVTINYGASLRNQPQYTHWVGSGNFVQ----HHHYNSGNLHNDISLIRTPHVDFWHLVNKV 143
            |  ..:.:..|.:..|||      |...|::    |.:|::..:||||:|:..           |
  Fly    84 AFIPWLVVVTGTNKYNQP------GGRYFLKAIHIHCNYDNPEMHNDIALLEL-----------V 131

  Fly   144 ELPSYNDRYQD--------YAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSRSWSLHDN 200
            |..::::|.|.        ..|...:.:|||.|......|..||.:.:|.:...:|....|..::
  Fly   132 EPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDED 196

  Fly   201 M----ICINTNGGKSTCGGDSGGPLVTHEGNRLVGVTSFVSSAGCQSGAPAVFSRVTGYLDWIRD 261
            .    ||..:..|:..|.||||||||::  ..|||:.::  ...|.:|.|.|.:.|..|.||||:
  Fly   197 CDVGHICTFSRLGEGACHGDSGGPLVSN--GYLVGLVNW--GWPCATGVPDVHASVYFYRDWIRN 257

  Fly   262  261
              Fly   258  257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 74/240 (31%)
Tryp_SPc 38..262 CDD:238113 76/243 (31%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 74/240 (31%)
Tryp_SPc 38..258 CDD:238113 76/243 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.