DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and sphinx1

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:280 Identity:73/280 - (26%)
Similarity:138/280 - (49%) Gaps:40/280 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFLALAVAAATAIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLF----SGNG 61
            |||.|  .|.|.:.|.....:.||.|          ||..||.|....:.|:||:::    :.:.
  Fly     1 MKLVV--TLLVLSLTVSVGEKNKLSP----------RIAGGYRAKTFTIIYLVGIVYFKSQTSSL 53

  Fly    62 NWWCGGSIIGNTWVLTAAHCTNGASGVTINYG---ASLRNQPQYTHW----VGSGNFVQHHHYNS 119
            |:. .|:||.|.|:||..        ..:.|.   ..|.::..|..:    :...||  ..||::
  Fly    54 NYG-AGTIISNQWILTVK--------TVLKYSYIEVHLASRRSYRGFDIIRIYKENF--RFHYDN 107

  Fly   120 GNLHNDISLIRTPHVDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQ 184
            .::   |:|::.|:..|...:::|.:|:|:.|::.|.|...:..|:|.....:.||:|::.::|:
  Fly   108 DHV---IALVKCPYQKFDRRMDRVRVPAYDTRFERYVGNMTMVCGYGTEKRHAKLPEWMRCIEVE 169

  Fly   185 IMSQSDCSRSWS-LHDNMICINTNGGKSTCGGDSGGPLVTHEGN-RLVGVTSFVSSAGCQSGAPA 247
            :|:.::|::.:: |....:|.:..|.|..|.||.||.:||...| ..:|:. ::....|..|.|:
  Fly   170 VMNNTECAKYYTPLKWYEMCTSGEGFKGVCEGDIGGAVVTMGPNPTFIGII-WLMPENCSIGYPS 233

  Fly   248 VFSRVTGYLDWIRDNTGISY 267
            |..||:.::.||:..:|:.:
  Fly   234 VHIRVSDHIKWIKRVSGVGF 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 60/234 (26%)
Tryp_SPc 38..262 CDD:238113 61/236 (26%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 60/234 (26%)
Tryp_SPc 26..248 CDD:304450 61/236 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470998
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.